Anti-h Inhibin beta A 9504 SPTN-5
Catalog Number: 100709
Key Features
Liquid, may turn slightly opaque during storage
Human
FIA
Custom Quote
- Bulk or bespoke? We IVDo that
Request a call back - to discuss your information requirements
Key Documents
Product Overview
Product Name | Anti-h Inhibin beta A 9504 SPTN-5 |
---|---|
Catalog Number | 100709 |
Description | Monoclonal mouse antibody, cultured in vitro under conditions free from animal-derived components. |
Application | FIA |
Further Specification
Form/Appearance | Liquid, may turn slightly opaque during storage |
---|---|
Concentration | 5.0 mg/ml (+/- 10 %) |
Isotype | IgG1 |
Clonality | Monoclonal |
Epitope | Amino acids 81-112 (CVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEE) |
Purity | ≥ 95 % |
Affinity constant | N/D |
Buffer | 50 mM Na-citrate, pH 6.0, 0.9 % NaCI, 0.095 % NaN3 as a preservative |
IEF Profile | 7.1–8.5 |
Cross Reactivity | N/D |
Specificity | Antibody recognizes human inhibin beta A subunit, also known as activin beta A |
Storage and Shipping
Storage | +2-8°C |
---|---|
Shipping | Cold packs |
Shelf Life | 36 months |